PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G120200.1
Common NameB456_011G120200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 96aa    MW: 11092.1 Da    PI: 10.7333
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G120200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.3e-182773148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g WT +Ed +l+++vkq+G + W+ Ia+ +  gR +kqc++rw+++l
  Gorai.011G120200.1 27 KGQWTDDEDRKLIRLVKQYGVRKWAQIAESLV-GRAGKQCRERWHNHL 73
                        799*****************************.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-241980IPR009057Homeodomain-like
PROSITE profilePS5129428.0062277IPR017930Myb domain
SuperFamilySSF466893.11E-192479IPR009057Homeodomain-like
SMARTSM007172.0E-162675IPR001005SANT/Myb domain
CDDcd001672.73E-143073No hitNo description
PfamPF139213.2E-173083No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MKASMKGDFP KWVVKRNTKV ASAALIKGQW TDDEDRKLIR LVKQYGVRKW AQIAESLVGR  60
AGKQCRERWH NHLRPNIKEM QCLASTLCMP LWIEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-202578558B-MYB
1h88_C7e-20197850109MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-20197850109MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454624.19e-49PREDICTED: transcription factor MYB44-like isoform X2
SwissprotQ9S7L23e-24MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0D2T6S51e-65A0A0D2T6S5_G
STRINGPOPTR_0009s04870.17e-29(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2740533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.11e-28myb domain protein 119
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]